PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P12280_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 193aa    MW: 21914 Da    PI: 9.5728
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P12280_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.31.4e-30959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien + rqvtfskRr g+lKKA+ELSvLCd+eva+iifss+gklye+ss
  GSMUA_Achr8P12280_001  9 KRIENATSRQVTFSKRRSGLLKKAYELSVLCDVEVALIIFSSRGKLYEFSS 59
                           79***********************************************96 PP

2K-box19.63.7e-0878116644
                  K-box   6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLe 44 
                            + s   e+++e++++e+a + k+ie L+ ++ +llGe+Le
  GSMUA_Achr8P12280_001  78 S-StIMEEDTEQWKHEAACMSKKIEHLEASKQKLLGENLE 116
                            3.3478999*****************************98 PP

3K-box13.43.4e-061221546799
                  K-box  67 skKnellleqieelqkkekelqeenkaLrkkle 99 
                            +++++ll+eqi++l++ke +l +en  L++k +
  GSMUA_Achr8P12280_001 122 ATQYHLLKEQISQLKEKESSLVKENALLSEKCK 154
                            5799************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.015161IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-41160IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-34390IPR002100Transcription factor, MADS-box
CDDcd002652.62E-43378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014866.6E-683117IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRSGLLK KAYELSVLCD VEVALIIFSS RGKLYEFSSS  60
SMQSTLERYR EYSREDTSST IMEEDTEQWK HEAACMSKKI EHLEASKQKL LGENLEKKGK  120
SATQYHLLKE QISQLKEKES SLVKENALLS EKCKRLPQLP SAASKGVPPF GTLGQHTEVE  180
TELRIGFPGR GTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-22383285Myocyte-specific enhancer factor 2A
3kov_B3e-22383285Myocyte-specific enhancer factor 2A
3kov_I3e-22383285Myocyte-specific enhancer factor 2A
3kov_J3e-22383285Myocyte-specific enhancer factor 2A
3p57_A3e-22383285Myocyte-specific enhancer factor 2A
3p57_B3e-22383285Myocyte-specific enhancer factor 2A
3p57_C3e-22383285Myocyte-specific enhancer factor 2A
3p57_D3e-22383285Myocyte-specific enhancer factor 2A
3p57_I3e-22383285Myocyte-specific enhancer factor 2A
3p57_J3e-22383285Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411419.11e-128PREDICTED: MADS-box transcription factor 50-like isoform X1
RefseqXP_009411420.11e-128PREDICTED: MADS-box transcription factor 50-like isoform X1
SwissprotQ9XJ606e-63MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0TPT11e-139M0TPT1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P12280_0011e-139(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.34e-51AGAMOUS-like 42